General Information

  • ID:  hor003204
  • Uniprot ID:  P02070??31-37)
  • Protein name:  Spinorphin
  • Gene name:  HBB
  • Organism:  Bos taurus (Bovine)
  • Family:  Globin family
  • Source:  animal
  • Expression:  Red blood cells.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Bos (genus), Bovinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0004601 peroxidase activity; GO:0005344 oxygen carrier activity; GO:0019825 oxygen binding; GO:0020037 heme binding; GO:0031720 haptoglobin binding; GO:0031721 hemoglobin alpha binding; GO:0043177 organic acid binding; GO:0046872 metal ion binding
  • GO BP:  GO:0015671 oxygen transport; GO:0042744 hydrogen peroxide catabolic process; GO:0098869 cellular oxidant detoxification
  • GO CC:  GO:0005833 hemoglobin complex; GO:0031838 haptoglobin-hemoglobin complex

Sequence Information

  • Sequence:  LVVYPWT
  • Length:  7(31-37)
  • Propeptide:  MLTAEEKAAVTAFWGKVKVDEVGGEALGRLLVVYPWTQRFFESFGDLSTADAVMNNPKVKAHGKKVLDSFSNGMKHLDDLKGTFAALSELHCDKLHVDPENFKLLGNVLVVVLARNFGKEFTPVLQADFQKVVAGVANALAHRYH
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Spinorphin has an antinociceptive effect, inhibitory effect on contraction of smooth muscle and anti-inflammatory effect.
  • Mechanism:  Inhibition of enkephalin-degrading enzymes
  • Cross BBB:  YES
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P02070-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor003204_AF2.pdbhor003204_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 98425 Formula: C45H64N8O10
Absent amino acids: ACDEFGHIKMNQRS Common amino acids: V
pI: 6.09 Basic residues: 0
Polar residues: 2 Hydrophobic residues: 4
Hydrophobicity: 110 Boman Index: 1262
Half-Life: 5.5 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 138.57
Instability Index: -1015.71 Extinction Coefficient cystines: 6990
Absorbance 280nm: 1165

Literature

  • PubMed ID:  11829145
  • Title:  Spinorphin, an Endogenous Inhibitor of Enkephalin-Degrading Enzymes, Potentiates Leu-Enkephalin-Induced Anti-Allodynic and Antinociceptive Effects in Mice